PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051947
Common NameLOC102593445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 612aa    MW: 65801.7 Da    PI: 6.828
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051947genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.21.2e-31256313260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers  d++++ei+Y+g+H+h+k
  PGSC0003DMP400051947 256 EDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-DGQITEIVYKGSHDHPK 313
                           7****************************************.***************85 PP

2WRKY106.11.8e-33427485159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  PGSC0003DMP400051947 427 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHD 485
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.3E-27245314IPR003657WRKY domain
PROSITE profilePS5081122.653250314IPR003657WRKY domain
SuperFamilySSF1182901.7E-24252314IPR003657WRKY domain
SMARTSM007749.1E-34255313IPR003657WRKY domain
PfamPF031066.1E-24256312IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37412487IPR003657WRKY domain
SuperFamilySSF1182902.22E-29419487IPR003657WRKY domain
PROSITE profilePS5081138.825422487IPR003657WRKY domain
SMARTSM007743.1E-39427486IPR003657WRKY domain
PfamPF031063.7E-26428485IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MEDSQSHSHS HPHQYTHSSP LPSINESSEQ VKFASSDAAF YPTVSSSVGS NIGAKYKLMS  60
PAKLPISRSS ACITIPPGLS PSSFLESPVL LSNIKAEPSP TTGSFSKFQL MQGSSGSAAF  120
SFMRSCSSGN AYGETTGEFE FKFAIASSST SGSLAKEAAV ISAGFNQQQS EPLIQVQDRS  180
LSQSLAPSTL VESEMPDSKE LSLPAPVSLE ASSISTSAAA TDNEEINQRG QSNPSSQGSH  240
ADNKDVSSVT AERSSEDGYN WRKYGQKLVK GSEFPRSYYK CTYPNCEVKK IFERSPDGQI  300
TEIVYKGSHD HPKPQPSRRF TPGALTSIQE DRGERDACLT GQEDKFNTNA QTSNTEPSGT  360
PLSPRQAGGD GLEGTVSQLH SANDQVDEDD PFAKRRKMDG GMDITPIVKP IREPRVVVQT  420
VSEVDILDDG YRWRKYGQKV VRGNPNPRSY YKCTNAGCPV RKHVERASHD PKAVITTYEG  480
KHNHDVPAAR TNNHEMAGSA PVTGGSRVRT EENGSVSLNL GVGIGYGMEN RRNGQLHNLP  540
AETVHSQAQV SSSSMMVVQP ATVAACYNIV NGGMSRFGTI ENRVQGTGFE TLPLQSSAQC  600
PQNYGRILLG P*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-38256488878Probable WRKY transcription factor 4
2lex_A5e-38256488878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135300.0BT013530.1 Lycopersicon esculentum clone 132248F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344883.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV01e-157WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLM1CX700.0M1CX70_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40252344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-153WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]